PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000246.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 131aa    MW: 14164.8 Da    PI: 5.0602
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000246.1_g00025.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB132.41.5e-4127119294
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +e +r lPianv+rimkkvlP naki+k+ake v+ec++efisf+tseas++ + ekrkt++gdd+l +l tlGf d+vepl+++l
  Itr_sc000246.1_g00025.1  27 SELERGLPIANVARIMKKVLPRNAKITKEAKEFVEECATEFISFITSEASERGRIEKRKTLTGDDVLNSLNTLGFGDFVEPLRAHL 112
                              577999******************************************************************************** PP

                    NF-YB  88 kkyrele 94 
                              +ky+e +
  Itr_sc000246.1_g00025.1 113 MKYKEND 119
                              ****965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-4220127IPR009072Histone-fold
SuperFamilySSF471133.06E-3331128IPR009072Histone-fold
PfamPF008086.4E-223293IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-126078No hitNo description
PRINTSPR006151.4E-127997No hitNo description
PRINTSPR006151.4E-1298116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MEGAPAGGGG GGGGGSQQSS QTEVEVSELE RGLPIANVAR IMKKVLPRNA KITKEAKEFV  60
EECATEFISF ITSEASERGR IEKRKTLTGD DVLNSLNTLG FGDFVEPLRA HLMKYKENDF  120
KEENKGSDSR G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-3526117192Transcription factor HapC (Eurofung)
4g92_B5e-3526117192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295779.15e-42nuclear transcription factor Y subunit B-1
RefseqXP_008442638.15e-42PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2
RefseqXP_011651935.15e-42PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2
SwissprotQ8VYK43e-40NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A103YD463e-42A0A103YD46_CYNCS; Histone-fold
STRINGGLYMA19G36220.21e-39(Glycine max)
STRINGPGSC0003DMT4000824646e-40(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.32e-39nuclear factor Y, subunit B8